PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G003000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 361aa    MW: 40601.7 Da    PI: 6.5466
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G003000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092883222155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yps++++  LA+++gL+++q+ +WF N+R ++
  Manes.16G003000.1.p 288 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 322
                          569*****************************885 PP

2ELK37.84.1e-13242263122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK qLlr YsgyLgsLkqEF+
  Manes.16G003000.1.p 242 ELKGQLLRRYSGYLGSLKQEFM 263
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-19107151IPR005540KNOX1
PfamPF037905.8E-22109147IPR005540KNOX1
SMARTSM012563.3E-26156207IPR005541KNOX2
PfamPF037915.5E-21159206IPR005541KNOX2
PROSITE profilePS5121310.912242262IPR005539ELK domain
SMARTSM011888.6E-8242263IPR005539ELK domain
PfamPF037891.8E-10242263IPR005539ELK domain
PROSITE profilePS5007112.989262325IPR001356Homeobox domain
SuperFamilySSF466892.05E-19264338IPR009057Homeodomain-like
SMARTSM003897.4E-13264329IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-28267327IPR009057Homeodomain-like
CDDcd000861.63E-12274326No hitNo description
PfamPF059206.5E-17282321IPR008422Homeobox KN domain
PROSITE patternPS000270300323IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEGGSNSTSC MMAFGDNSNG LCPMMMMMPL MTSHHHHHHH HHPPPPPPPH PNADSSSNTL  60
FLPLPPTNNQ DQNRNSGSGS STILDDHNHN NSNIGCYFMD NNDSNIPSVK AKIMAHPHYH  120
RLLAAYINCQ KVGAPPDVVA RLEDACASAA AMGPTGTSCI GEDPALDQFM EAYCEMLTKY  180
EQELSKPFKE AMLFLQRVEC QFKALTVSSP NSACGEGNER NGSSEEEVDV NNFIDPQAED  240
QELKGQLLRR YSGYLGSLKQ EFMKKRKKGK LPKEARQQLL DWWSRHYKWP YPSESQKLAL  300
AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FVVMDATHSH YYMDNVLGNP FPMDISPTLL  360
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257266LKQEFMKKRK
2263267KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-162HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9RXF10.0B9RXF1_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_10s0116g00190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor